CDS

Accession Number TCMCG051C40873
gbkey CDS
Protein Id XP_024440616.1
Location complement(join(18901516..18901561,18902045..18902133,18902275..18902376))
Gene LOC112324062
GeneID 112324062
Organism Populus trichocarpa

Protein

Length 78aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA17973
db_source XM_024584848.1
Definition elongation factor Ts, mitochondrial-like [Populus trichocarpa]

EGGNOG-MAPPER Annotation

COG_category J
Description Associates with the EF-Tu.GDP complex and induces the exchange of GDP to GTP. It remains bound to the aminoacyl-tRNA.EF- Tu.GTP complex up to the GTP hydrolysis stage on the ribosome
KEGG_TC -
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE -
KEGG_ko -
EC -
KEGG_Pathway -
GOs GO:0003674        [VIEW IN EMBL-EBI]
GO:0003676        [VIEW IN EMBL-EBI]
GO:0003723        [VIEW IN EMBL-EBI]
GO:0003746        [VIEW IN EMBL-EBI]
GO:0005488        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005739        [VIEW IN EMBL-EBI]
GO:0005759        [VIEW IN EMBL-EBI]
GO:0006412        [VIEW IN EMBL-EBI]
GO:0006414        [VIEW IN EMBL-EBI]
GO:0006518        [VIEW IN EMBL-EBI]
GO:0006807        [VIEW IN EMBL-EBI]
GO:0008135        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0008152        [VIEW IN EMBL-EBI]
GO:0009058        [VIEW IN EMBL-EBI]
GO:0009059        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0010467        [VIEW IN EMBL-EBI]
GO:0019538        [VIEW IN EMBL-EBI]
GO:0031974        [VIEW IN EMBL-EBI]
GO:0032543        [VIEW IN EMBL-EBI]
GO:0034641        [VIEW IN EMBL-EBI]
GO:0034645        [VIEW IN EMBL-EBI]
GO:0043043        [VIEW IN EMBL-EBI]
GO:0043170        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043233        [VIEW IN EMBL-EBI]
GO:0043603        [VIEW IN EMBL-EBI]
GO:0043604        [VIEW IN EMBL-EBI]
GO:0044237        [VIEW IN EMBL-EBI]
GO:0044238        [VIEW IN EMBL-EBI]
GO:0044249        [VIEW IN EMBL-EBI]
GO:0044260        [VIEW IN EMBL-EBI]
GO:0044267        [VIEW IN EMBL-EBI]
GO:0044271        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044429        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0070013        [VIEW IN EMBL-EBI]
GO:0070125        [VIEW IN EMBL-EBI]
GO:0071704        [VIEW IN EMBL-EBI]
GO:0097159        [VIEW IN EMBL-EBI]
GO:0140053        [VIEW IN EMBL-EBI]
GO:1901363        [VIEW IN EMBL-EBI]
GO:1901564        [VIEW IN EMBL-EBI]
GO:1901566        [VIEW IN EMBL-EBI]
GO:1901576        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGGCCATAGAGAAAATGGTGGAAGGCCGTTTGCGTAAATACTACGAGGAAGTTGTTTTGATGGAGCAAAAATTTGTTATGAATGATACAATGAACGTAAAGACACTGCTCAGCAATCTATCGAAGGAAGTGGGCTCGCCTGTGAAGATAGGTAACTTTTTCAGAATGGAAGTTGGAGAGGGAATTCAAAGGGAGGAGGCGTTGGGTGCAGATGAACCAGTGGCTCAGGCAGCTTGA
Protein:  
MAIEKMVEGRLRKYYEEVVLMEQKFVMNDTMNVKTLLSNLSKEVGSPVKIGNFFRMEVGEGIQREEALGADEPVAQAA